PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00857.1.p
Common NameEUGRSUZ_B00857, LOC104422048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 1173aa    MW: 130866 Da    PI: 7.6812
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00857.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.7e-09430474246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       grWT eEd++l+  +++ G ++W  +a  +g++Rt+ qc  r+q 
  Eucgr.B00857.1.p 430 GRWTVEEDKRLLFSIQEKGINNWFEVAVSLGTKRTPFQCLARYQR 474
                       8******************************99**********96 PP

2Myb_DNA-binding461.3e-14482528148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +  WT++Ed +l  av+ lG g+W ++a+ +  gRt+ qc +rw k l
  Eucgr.B00857.1.p 482 KSEWTPDEDAQLRAAVEILGEGDWQAVASALE-GRTGTQCSNRWKKTL 528
                       578*****************************.***********9975 PP

3Myb_DNA-binding51.42.4e-16536579246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       grWT++Ed++l  avk++G+++W +Ia  ++ gRt  qc++rw +
  Eucgr.B00857.1.p 536 GRWTADEDKRLRVAVKLFGPKNWMKIADFVP-GRTQVQCRERWVN 579
                       8******************************.***********87 PP

4Myb_DNA-binding41.72.6e-13589630346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +WT+eEd  l  a++++G   W++Ia+++   Rt++qc+ rw  
  Eucgr.B00857.1.p 589 PWTPEEDTMLEAAIAEHGYF-WSKIAACLA-PRTDNQCRRRWKV 630
                       8*****************88.*********.9**********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.645327423IPR017877Myb-like domain
SMARTSM007170.99331425IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-9334350IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-9396435IPR009057Homeodomain-like
SuperFamilySSF466893.74E-12405462IPR009057Homeodomain-like
PROSITE profilePS500909.094424476IPR017877Myb-like domain
SMARTSM007172.2E-8428478IPR001005SANT/Myb domain
PfamPF002491.5E-6430474IPR001005SANT/Myb domain
CDDcd001671.85E-6431476No hitNo description
Gene3DG3DSA:1.10.10.607.8E-11436484IPR009057Homeodomain-like
SuperFamilySSF466894.02E-19461530IPR009057Homeodomain-like
PROSITE profilePS5129416.624477528IPR017930Myb domain
SMARTSM007177.2E-15481530IPR001005SANT/Myb domain
PfamPF002494.6E-13482527IPR001005SANT/Myb domain
CDDcd001674.35E-12484528No hitNo description
Gene3DG3DSA:1.10.10.604.2E-16485531IPR009057Homeodomain-like
PROSITE profilePS5129421.873529585IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-18532581IPR009057Homeodomain-like
SuperFamilySSF466893.14E-28533628IPR009057Homeodomain-like
SMARTSM007171.8E-14534583IPR001005SANT/Myb domain
PfamPF002495.6E-15536579IPR001005SANT/Myb domain
CDDcd001671.27E-12537581No hitNo description
Gene3DG3DSA:1.10.10.608.9E-17582629IPR009057Homeodomain-like
SMARTSM007175.5E-13586634IPR001005SANT/Myb domain
PfamPF002498.5E-12588629IPR001005SANT/Myb domain
PROSITE profilePS5129416.072589636IPR017930Myb domain
CDDcd001672.85E-12589632No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1173 aa     Download sequence    Send to blast
MSHGLGRRGG GSDDDDDDDE VSSGSEDGGA SFDEDMEALR RACMLTGADV VRADGLDFAA  60
PDPGSAAADD DDDDDDDEDD LQLVRRLQER FSADLANPLT LKPLASLHPP PTAAAAAAAT  120
SDEDEDDFET LRAIQNRFCS YDHSNTENSK NGLSSTGSMS NAMNVNIFGG CKVFPDDEDA  180
HDSNQTLNKD ECQPSAIIEW HQPAQKQQGL AKYSSFPKSG QIFIDTLKKN RSCQKLIRSK  240
LIQIEARIEE IKKLKERVKI LKDFQISCRQ RTGKALSQKK DPRVQLISAR KTIKDSKVND  300
RKVSAVHYGP AENSHVSSYR MALTRFPLSL QRSKWSEVEK ENLGKGTKQQ FQETLLQISL  360
ERFSAPDGDQ YGFEDILSSI RDLDITPESI REFLPKVNWD QLASLYIPGR SGAECEARWL  420
NWEDPLINHG RWTVEEDKRL LFSIQEKGIN NWFEVAVSLG TKRTPFQCLA RYQRSLNPCI  480
LKSEWTPDED AQLRAAVEIL GEGDWQAVAS ALEGRTGTQC SNRWKKTLHP ARQRVGRWTA  540
DEDKRLRVAV KLFGPKNWMK IADFVPGRTQ VQCRERWVNS LDPSLNWNPW TPEEDTMLEA  600
AIAEHGYFWS KIAACLAPRT DNQCRRRWKV VFPNEVPLLR EARKVQKAAL VRNFVDRESE  660
RPALGPGDFL PLPMTSCVSD PDSLNPSMKQ KTGLSDLEKV GSRRKRKANR SNAVQVSRSS  720
YNEVDYDELA EHGSSKNTRV TKPFSGKSRH RKQAKYHISQ PISTTSVPNG EISEVNGLSC  780
IGEQGKISSR VQKKVDPKKP QINSGLVVKK ASCKNDETLA KHGSLLRNKK VTKLQSNEGK  840
PNGLAVDHSS CQLDPTSLIM ANDENCQVQG MSDSSRKTKT VTCDQEVGNK RPRVDSQLDL  900
EQAVEIISCN EEERLTRDNT VSKKRKLSNA RVRKDNHNER SKDQQSSQPD PSSSLTTKGK  960
NMEAHDTANM TEKKNIPSRA QKKLGPEKTR NDGHFHRSKD DVVEDVSAEL IASKEHGNYK  1020
TYKRRKRNVA PPDTCYSNSE CIPALPEKLN RSQPVSIDGP EQLMTGNEPV SQQVPDADNC  1080
DVTLASLLIK KQMKKAVLTS SEGNGMPSDV DQMPPNAVCR GKEPNLLGTS NGNAPSGGPT  1140
REETRNDLAF DHEDGDITLA GFLHNKSMKK RP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-303986286155MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-303986286155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00857.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032570.10.0PREDICTED: uncharacterized protein LOC104422048 isoform X1
TrEMBLA0A059CZT70.0A0A059CZT7_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1